.
The Open Protein Structure Annotation Network
PDB Keyword
.

1hf2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Bacterial Cell-Division Inhibitor Minc. Embo J. 20 2454 2001
    Site OTHER
    PDB Id 1hf2 Target Id PDB1HF2
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS20028, TM1047 Molecular Weight 22725.88 Da.
    Residues 210 Isoelectric Point 8.01
    Sequence mvdfkmtkeglvllikdyqnleevlnaisaritqmggffakgdrislmienhnkhsqdiprivshlrnlg levsqilvgstvegkendlkvqsrttvestgkvikrnirsgqtvvhsgdvivfgnvnkgaeilaggsvv vfgkaqgniraglneggqavvaaldlqtsliqiagfithskgeenvpsiahvkgnriviepfdkvsfer se
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.2 Rfree 0.3001
    Matthews' coefficent 2.33 Rfactor 0.237
    Waters 660 Solvent Content 48

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch