.
The Open Protein Structure Annotation Network
PDB Keyword
.

1hl8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Thermotoga Maritima Alpha-L-Fucosidase. Insights Into the Catalytic Mechanism and the Molecular Basis for Fucosidosis. J.Biol.Chem. 279 13119 2004
    Site OTHER
    PDB Id 1hl8 Target Id PDB1HL8
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18706, TM0306 Molecular Weight 52202.71 Da.
    Residues 449 Isoelectric Point 5.81
    Sequence mismkprykpdweslrehtvpkwfdkakfgifihwgiysvpgwatptgelgkvpmdawffqnpyaewyen slrikesptweyhvktygenfeyekfadlftaekwdpqewadlfkkagakyvipttkhhdgfclwgtky tdfnsvkrgpkrdlvgdlakavreaglrfgvyysggldwrfttepirypedlsyirpntyeyadyaykq vmelvdlylpdvlwndmgwpekgkedlkylfayyynkhpegsvndrwgvphwdfktaeyhvnypgdlpg ykweftrgiglsfgynrnegpehmlsveqlvytlvdvvskggnlllnvgpkgdgtipdlqkerllglge wlrkygdaiygtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltge rlsfknvgknleitvpkklletdsitlvleavee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.4 Rfree 0.228
    Matthews' coefficent 2.37 Rfactor 0.185
    Waters 162 Solvent Content 47.6

    Pathway

    Reactions found in Metabolic Reconstruction for TM0306

    Name: "alpha-fucosidase, cytosol"
    Metabolic Subsystem: Carbohydrate Metabolism
    Reaction: : h2o + ksi --> fuc-L + ksi_deg1
    Classification: EC:3.2.1.51
     
    Name: "alpha-fucosidase, cytosol"
    Metabolic Subsystem: Carbohydrate Metabolism
    Reaction: : h2o + s2l2fn2m2masn --> fuc-L + s2l2n2m2masn
    Classification: EC:3.2.1.51
     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch