The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure and interactions of CheW from Thermotoga maritima. Nat.Struct.Biol. 9 121-125 2002
    Site OTHER
    PDB Id 1k0s Target Id PDB1K0S
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS20036, TM0701 Molecular Weight 16953.94 Da.
    Residues 151 Isoelectric Point 5.15
    Sequence mktladalkefevlsfeideqalafdvdniemvieksditpvpksrhfvegvinlrgriipvvnlakilg isfdeqkmksiivartkdvevgflvdrvlgvlritenqldltnvsdkfgkkskglvktdgrliiyldid kiieeitvkegv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch