.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kgs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Evidence of intradomain and interdomain flexibility in an OmpR/PhoB homolog from Thermotoga maritima. Structure 10 153-164 2002
    Site OTHER
    PDB Id 1kgs Target Id PDB1KGS
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS20002, TM0399 Molecular Weight 26013.89 Da.
    Residues 225 Isoelectric Point 5.93
    Sequence mnvrvlvvederdladlitealkkemftvdvcydgeegmymalnepfdvvildimlpvhdgweilksmre sgvntpvlmltalsdveyrvkglnmgaddylpkpfdlreliarvralirrkseskstklvcgdlildta tkkayrgskeidltkkeyqileylvmnknrvvtkeelqehlwsfddevfsdvlrshiknlrkkvdkgfk kkiihtvrgigyvarde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.2098400
    Matthews' coefficent 2.43 Rfactor 0.1791100
    Waters 206 Solvent Content 49.48

    Ligand Information
    Ligands SCN (THIOCYANATE) x 6
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch