.
The Open Protein Structure Annotation Network
PDB Keyword
.

1l1j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Protease Domain of a Heat-shock Protein HtrA from Thermotoga maritima. J.BIOL.CHEM. 278 6543-6551 2003
    Site OTHER
    PDB Id 1l1j Target Id PDB1L1J
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26091, TM0571 Molecular Weight 25906.21 Da.
    Residues 239 Isoelectric Point 4.93
    Sequence dyespivnvveacapavvkidvvktvktsffdpyfeqffkkwfgelppgferqvaslgsgfifdpegyil tnyhvvggadnitvtmldgskydaeyiggdeeldiavikikasdkkfpylefgdsdkvkigewaiaign plgfqhtvtvgvvsatnrripkpdgsgyyvgliqtdaainpgnsggpllnihgevigintaivnpqeav nlgfaipintvkkfldtiltqkkvekaylgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.278
    Matthews' coefficent 2.81 Rfactor 0.228
    Waters 58 Solvent Content 56.28

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch