.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lbm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Two (betaalpha)(8)-barrel enzymes of histidine and tryptophan biosynthesis have similar reaction mechanisms and common strategies for protecting their labile substrates. Biochemistry 41 12032-12042 2002
    Site OTHER
    PDB Id 1lbm Target Id PDB1LBM
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18695, TM0139 Molecular Weight 23039.32 Da.
    Residues 205 Isoelectric Point 6.20
    Sequence mvrvkicgitnledalfsvesgadavgfvfypkskryispedarrisvelppfvfrvgvfvneepekild vasyvqlnavqlhgeepielcrkiaerilvikavgvsnerdmeralnyrefpilldtktpeyggsgktf dwslilpyrdrfrylvlsgglnpenvrsaidvvrpfavdvssgveafpgkkdhdsikmfiknakgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.228
    Matthews' coefficent 2.77 Rfactor 0.17
    Waters 69 Solvent Content 55.64

    Pathway

    Reactions found in Metabolic Reconstruction for TM0139

    Name: phosphoribosylanthranilate isomerase
    Metabolic Subsystem: Phenylalanine Tyrosine Tryptophan Biosynthesis
    Reaction: : pran <==> 2cpr5p
    Classification: EC:5.3.1.24
     

    Ligand Information
    Ligands 137 (1-(O-CARBOXY-PHENYLAMINO)-1-DEOXY-D-RIBULOSE-5-) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch