The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the middle and C-terminal domains of the flagellar rotor protein FliG. EMBO J. 21 3225-3234 2002
    Site OTHER
    PDB Id 1lkv Target Id PDB1LKV
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19988, TM0220 Molecular Weight 26335.09 Da.
    Residues 232 Isoelectric Point 5.11
    Sequence qvkpfsfvrdtdpvqlvnflqsehpqtiavvlsyldppvaaqilgalpeelqtevlkriallertspevv keiernlekkisgfvsrtfskvggidtaaeimnnldrttekkimdklvqenpeladeirrrmfvfedil klddrsiqlvlrevdtrdlalalkgasdelkekifknmskraaallkdeleymgpvrlkdveeaqqkii niirrleeageiviargggeelim
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.2800900
    Matthews' coefficent 4.58 Rfactor 0.2554800
    Waters 5 Solvent Content 73.12

    Ligand Information
    Metals CA (CALCIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch