.
The Open Protein Structure Annotation Network
PDB Keyword
.

1m4y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Isolation and characterization of the prokaryotic proteasome homolog HslVU (ClpQY) from Thermotoga maritima and the crystal structure of HslV. BIOPHYS.CHEM. 100 437-452 2003
    Site OTHER
    PDB Id 1m4y Target Id PDB1M4Y
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS20020, TM0521 Molecular Weight 18331.04 Da.
    Residues 171 Isoelectric Point 6.29
    Sequence ttilvvrrngqtvmggdgqvtfgstvlkgnarkvrklgegkvlagfagsvadamtlfdrfeaklrewggn ltkaavelakdwrtdrvlrrlealllvadkenifiisgngeviqpdddaaaigsggpyalaaakallrn tdlsareivekamtiageiciytnqnivieev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.10 Rfree 0.229
    Matthews' coefficent 2.41 Rfactor 0.192
    Waters 198 Solvent Content 49.00

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch