.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o63

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of a set of proteins resulting from a bacterial genomics project. Proteins 60 787-796 2005
    Site OTHER
    PDB Id 1o63 Target Id PDB1O63
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19957, TM1042 Molecular Weight 24732.32 Da.
    Residues 219 Isoelectric Point 6.79
    Sequence sllklaipkgrleekvmtylkktgviferessilregkdivcfmvrpfdvptylvhgvadigfcgtdvll eketsliqpffiptnisrmvlagpkgrgipegekriatkfpnvtqryceskgwhcriiplkgsvelapi aglsdlivditetgrtlkennleildeifvirthvvvnpvsyrtkreevvsfleklqeviehdsneqsr geggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.264
    Matthews' coefficent Rfactor 0.219
    Waters 104 Solvent Content

    Pathway

    Reactions found in Metabolic Reconstruction for TM1042

    Name: ATP phosphoribosyltransferase reversible
    Other genes that carryout this rxn:TM1043
    Metabolic Subsystem: Histidine Biosynthesis
    Reaction: : atp + prpp <==> ppi + prbatp
    Classification: EC:2.4.2.17
     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch