.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o6d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of a set of proteins resulting from a bacterial genomics project. Proteins 60 787-796 2005
    Site OTHER
    PDB Id 1o6d Target Id PDB1O6D
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS20010, TM0844 Molecular Weight 18943.09 Da.
    Residues 163 Isoelectric Point 7.94
    Sequence mslrvriavigkldgfikegikhyekflrrfckpevleikrvhrgsieeivrketedltnrilpgsfvmv mdkrgeevsseefadflkdlemkgkditiliggpyglneeifakahrvfslskmtfthgmtvlivleqi frafkiihgenyhyeggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.66 Rfree 0.261
    Matthews' coefficent Rfactor 0.229
    Waters 164 Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch