.
The Open Protein Structure Annotation Network
PDB Keyword
.

1obb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Thermotoga Maritima Alpha-Glucosidase Agla Defines a New Clan of Nad+-Dependent Glycosidases. J.Biol.Chem. 278 19151-19158 2003
    Site OTHER
    PDB Id 1obb Target Id PDB1OBB
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19944, TM1834 Molecular Weight 55044.42 Da.
    Residues 480 Isoelectric Point 5.68
    Sequence mpsvkigiigagsavfslrlvsdlcktpglsgstvtlmdideerldailtiakkyveevgadlkfektmn lddviidadfvintamvgghtylekvrqigekygyyrgidaqefnmvsdyytfsnynqlkyfvdiarki eklspkawylqaanpifegttlvtrtvpikavgfchghygvmeiveklgleeekvdwqvagvnhgiwln rfrynggnayplldkwieekskdwkpenpfndqlspaaidmyrfygvmpigdtvrnsswryhrdletkk kwygepwggadseigwkwyqdtlgkvteitkkvakfikenpsvrlsdlgsvlgkdlsekqfvlevekil dperksgeqhipfidallndnkarfvvnipnkgiihgidddvvvevpalvdkngihpekiepplpdrvv kyylrprimrmemaleafltgdiriikellyrdprtksdeqvekvieeilalpeneemrkhylkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.235
    Matthews' coefficent 2.586 Rfactor 0.199
    Waters 646 Solvent Content 50.6

    Pathway

    Reactions found in Metabolic Reconstruction for TM1834

    Name: alpha-glucosidase
    Metabolic Subsystem: Alternate Carbon Metabolism
    Reaction: : h2o + malt --> glc-D
    Classification: EC:3.2.1.20
     

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 2;MAL (MALTOSE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch