.
The Open Protein Structure Annotation Network
PDB Keyword
.

1p2f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of the domain interface in DrrB, a response regulator of the OmpR/PhoB subfamily. J.Bacteriol. 185 4186-4194 2003
    Site OTHER
    PDB Id 1p2f Target Id PDB1P2F
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19984, TM0126 Molecular Weight 25519.38 Da.
    Residues 220 Isoelectric Point 5.89
    Sequence mmwkiavvdddknilkkvseklqqlgrvktfltgedflndeeafhvvvldvmlpdysgyeicrmiketrp etwvilltllsddesvlkgfeagaddyvtkpfnpeillarvkrflerekkglydfgdlkidatgftvfl kgkrihlpkkefeillflaenagkvvtreklletfwedpvsprvvdtvikrirkaieddpnrpryikti wgvgymftgger
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.224
    Matthews' coefficent 2.45 Rfactor 0.198
    Waters 163 Solvent Content 49.40

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch