The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Evidence for Evolution of the Beta/Alpha-Barrel Scaffold by Repeated Gene Duplication and Fusion. Science 289 1546 2000
    Site OTHER
    PDB Id 1qo2 Target Id PDB1QO2
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18708, TM1037 Molecular Weight 27026.82 Da.
    Residues 241 Isoelectric Point 5.71
    Sequence mlvvpaidlfrgkvarmikgrkentifyekdpvelveklieegftlihvvdlsnaiensgenlpvlekls efaehiqigggirsldyaeklrklgyrrqivsskvledpsflkslreidvepvfsldtrggrvafkgwl aeeeidpvsllkrlkeygleeivhteiekdgtlqehdfsltkkiaieaevkvlaaggissenslktaqk vhtetngllkgvivgraflegiltvevmkryar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.246
    Matthews' coefficent 1.82 Rfactor 0.188
    Waters 547 Solvent Content 31.86


    Reactions found in Metabolic Reconstruction for TM1037

    Name: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase (irreversible)
    Metabolic Subsystem: Histidine Biosynthesis
    Reaction: : prfp --> prlp
    Classification: EC:

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch