.
The Open Protein Structure Annotation Network
PDB Keyword
.

1r3e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of tRNA Pseudouridine Synthase TruB and Its RNA Complex: RNA Recognition Through a Combination of Rigid Docking and Induced Fit. Proc.Natl.Acad.Sci.USA 100 12648-12653 2003
    Site OTHER
    PDB Id 1r3e Target Id PDB1R3E
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS20034, TM0856 Molecular Weight 35457.33 Da.
    Residues 309 Isoelectric Point 8.44
    Sequence mkhgilvaykpkgptshdvvdevrkklktrkvghggtldpfacgvliigvnqgtrilefykdlkkvywvk mrlglitetfditgevveerecnvteeeireaifsfvgeydqvppaysakkykgerlyklaregkiinl ppkrvkifkiwdvniegrdvsfrvevspgtyirslcmdigyklgcgatavelvresvgphtieeslnvf eaapeeienriiplekclewlprvvvhqestkmilngsqihlemlkewdgfkkgevvrvfneegrllal aeaernssfletlrkhernervltlrkvfntr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.273
    Matthews' coefficent 3.36 Rfactor 0.223
    Waters 263 Solvent Content 63.41

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch