The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title An NMR-derived model for the solution structure of oxidized Thermotoga maritima 1[Fe4-S4] ferredoxin. Eur.J.Biochem. 237 726-735 1996
    Site OTHER
    PDB Id 1rof Target Id PDB1ROF
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18714, TM0927 Molecular Weight 6212.66 Da.
    Residues 60 Isoelectric Point 4.15
    Sequence mkvrvdadacigcgvcenlcpdvfqlgddgkakvlqpetdlpcakdaadscptgaisvee
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands SF4 (IRON/SULFUR) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch