.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tzt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of the antitermination factor NusB from Thermotoga maritima and implications for RNA binding. Biochem.J. 383 419-428 2004
    Site OTHER
    PDB Id 1tzt Target Id PDB1TZT
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19978, TM1765 Molecular Weight 16972.62 Da.
    Residues 142 Isoelectric Point 6.20
    Sequence mktprrrmrlavfkalfqhefrrdedleqileeildetydkkakedarryirgikenlsmiddlisryle kwslnrlsvvdrnvlrlatyellfekdipievtideaieiakrygtensgkfvngildriakehapkek fel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.55 Rfree 0.25096
    Matthews' coefficent 2.10 Rfactor 0.23492
    Waters 392 Solvent Content 41.30

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch