.
The Open Protein Structure Annotation Network
PDB Keyword
.

1uyp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Three-Dimensional Structure of Invertase ({Beta}-Fructosidase) from Thermotoga Maritima Reveals a Bimodular Arrangement and an Evolutionary Relationship between Retaining and Inverting Glycosidases. J.Biol.Chem. 279 18903 2004
    Site OTHER
    PDB Id 1uyp Target Id PDB1UYP
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18720, TM1414 Molecular Weight 49820.87 Da.
    Residues 432 Isoelectric Point 5.28
    Sequence lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhlpvalypddet hgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkydgnpviskppeegthafrdp kvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegaifedettkeiecpdlvrigekdiliysit stnsvlfsmgelkegklnvekrglldhgtdfyaaqtffgtdrvvvigwlqswlrtglyptkregwngvm slprelyvennelkvkpvdellalrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevv itksrdelivdttrsgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsv ksnqvklevfeleniwl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.90 Rfree 0.220
    Matthews' coefficent 2.2 Rfactor 0.177
    Waters 1756 Solvent Content 43

    Pathway

    Reactions found in Metabolic Reconstruction for TM1414

    Name: raffinose hydrolyzing enzyme
    Metabolic Subsystem: Raffinose Metabolism
    Reaction: : h2o + raffin --> fru + melib
    Classification: EC:3.2.1.26
     
    Name: sucrose hydrolyzing enzyme
    Other genes that carryout this rxn:TM0752 TM1068
    Metabolic Subsystem: Sucrose Metabolism
    Reaction: : h2o + sucr --> fru + glc-D
    Classification: EC:3.2.1.26
     

    Ligand Information
    Ligands SO4 (SULFATE) x 14;CIT (CITRIC) x 1;GOL (GLYCEROL) x 6
    Metals NA (SODIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch