The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Octaprenyl Pyrophosphate Synthase from Hyperthermophilic Thermotoga maritima and Mechanism of Product Chain Length Determination. J.Biol.Chem. 279 4903-4912 2004
    Site OTHER
    PDB Id 1v4e Target Id PDB1V4E
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19951, TM1535 Molecular Weight 33856.56 Da.
    Residues 299 Isoelectric Point 5.40
    Sequence mtknklnqnsyelekvkerieqilsqffpeqimkdlplygkmlrvrlsilsfknrgveigedaisslaal elvhlasllhddvidgarfrrgketinfmygdkaavaagdlvlvsafhtveeignnklrraflnvigkm seaelieqlsrykpitkeeylrivegksgalfglalqlpallegelgedlynlgvtigtiyqmfddimd fagmekigkdgfldlkngvasfplvtamekfpearqmfenrdwsglmsfmrekgilkeceetlkvlvkn viienswlrdfvdgifkikiss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.28 Rfree 0.2858
    Matthews' coefficent 2.76 Rfactor 0.2264
    Waters 682 Solvent Content 55.14


    Reactions found in Metabolic Reconstruction for TM1535

    Name: Octaprenyl pyrophosphate synthase
    Metabolic Subsystem: Terpenoid biosynthesis
    Reaction: : frdp + ipdp --> octdp + ppi


    Ligand Information
    Ligands SO4 (SULFATE) x 7



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch