.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vbr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of the substrate subsite and the highly thermal stability of xylanase 10B from Thermotoga maritima MSB8. Proteins 61 999-1009 2005
    Site OTHER
    PDB Id 1vbr Target Id PDB1VBR
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19946, TM0070 Molecular Weight 38648.02 Da.
    Residues 328 Isoelectric Point 5.54
    Sequence sqnvslrelaeklniyigfaainnfwslsdaekymevarrefniltpenqmkwdtihperdrynftpaek hvefaeendmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvshfkgrvkiwdvvneavsds gtyresvwyktigpeyiekafrwakeadpdailiyndysieeinaksnfvynmikelkekgvpvdgigf qmhidyrglnydsfrrnlerfaklglqiyitemdvriplsgseeyylkkqaevcakifdicldnpavka iqfwgftdkyswvpgffkgygkallfdenynpkpcyyaikevlekkieerk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.215
    Matthews' coefficent 2.15 Rfactor 0.181
    Waters 646 Solvent Content 42.27

    Pathway

    Reactions found in Metabolic Reconstruction for TM0070

    Name: xylanase (endo-acting) (extracellular)
    Other genes that carryout this rxn: TM0061
    Metabolic Subsystem: Xylan Metabolism
    Reaction: : h2o + xylan8 --> xylan4

     
    Name: xylanase (endo-acting) (extracellular)
    Other genes that carryout this rxn:TM0061
    Metabolic Subsystem: Xylan Metabolism
    Reaction: : h2o + xylan12 --> xylan4 + xylan8

     

    Ligand Information
    Ligands XYS-XYP (XYLOPYRANOSE) x 2;ACY (BETA-D-XYLOPYRANOSE) x 6
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch