.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vhn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 1.59 A resolution crystal structure of TM0096, a flavin mononucleotide binding protein from Thermotoga maritima. Proteins 55 772-774 2004
    Site OTHER
    PDB Id 1vhn Target Id PDB1VHN
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS20012, TM0096 Molecular Weight 36502.25 Da.
    Residues 318 Isoelectric Point 9.10
    Sequence mslevkvglapmagytdsafrtlafewgadfafsemvsakgflmnsqkteellpqphernvavqifgsep nelseaarilsekykwidlnagcpvrkvvkegaggallkdlrhfryivrelrksvsgkfsvktrlgwek neveeiyrilveegvdevfihtrtvvqsftgraewkalsvlekriptfvsgdiftpedakraleesgcd gllvargaigrpwifkqikdflrsgkysepsreeilrtferhlelliktkgerkavvemrkflagytkd lkgarrfrekvmkieevqilkemfynfikeveggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.59 Rfree 0.227
    Matthews' coefficent 2.44 Rfactor 0.189
    Waters 315 Solvent Content 49.64

    Ligand Information
    Ligands SO4 (SULFATE) x 3;FMN (FLAVIN) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch