.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vpe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Closed structure of phosphoglycerate kinase from Thermotoga maritima reveals the catalytic mechanism and determinants of thermal stability. Structure 5 1475-1483 1997
    Site OTHER
    PDB Id 1vpe Target Id PDB1VPE
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26069, TM0689 Molecular Weight 42982.64 Da.
    Residues 398 Isoelectric Point 5.88
    Sequence ekmtirdvdlkgkrvimrvdfnvpvkdgvvqddtriraalptikyaleqgakvillshlgrpkgepspef slapvakrlsellgkevkfvpavvgdevkkaveelkegevlllentrfhpgetkndpelakfwasladi hvndafgtahrahasnvgiaqfipsvagflmekeikflskvtynpekpyvvvlggakvsdkigvitnlm ekadriliggammftflkalgkevgssrveedkidlakelvekakekgveivlpvdaviaqkiepgvek kvvriddgipegwmgldigpetielfkqklsdaktvvwngpmgvfeiddfaegtkqvalaiaaltekga itvvgggdsaaavnkfgledkfshvstgggasleflegkelpgiasmrikka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2880000
    Matthews' coefficent 2.41 Rfactor 0.1980000
    Waters 226 Solvent Content 49.00

    Pathway

    Reactions found in Metabolic Reconstruction for TM0689

    Name: phosphoglycerate kinase
    Metabolic Subsystem: Glycolysis/Gluconeogenesis
    Reaction: : 3pg + atp <==> 13dpg + adp
    Classification: EC:2.7.2.3
     
    Name: triose-phosphate isomerase
    Metabolic Subsystem: Glycolysis/Gluconeogenesis
    Reaction: : dhap <==> g3p
    Classification: EC:5.3.1.1
     

    Ligand Information
    Ligands ANP (PHOSPHOAMINOPHOSPHONIC) x 1;3PG (3-PHOSPHOGLYCERIC) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch