.
The Open Protein Structure Annotation Network
PDB Keyword
.

1w5f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Insights Into Ftsz Protofilament Formation. Nat.Struct.Mol.Biol. 11 1243 2004
    Site OTHER
    PDB Id 1w5f Target Id PDB1W5F
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19996, TM0836 Molecular Weight 38617.37 Da.
    Residues 353 Isoelectric Point 5.68
    Sequence mgfdldvekkkenrnipqannlkikvigvggagnnainrmieigihgvefvavntdlqvleasnadvkiq igenitrglgaggrpeigeqaaleseekirevlqdthmvfitagfgggtgtgaspviakiakemgiltv aivttpfyfegperlkkaieglkklrkhvdtlikisnnklmeelprdvkikdaflkadetlhqgvkgis elitkrgyirltsrfariesvmkdagaailgigvgkgehrareaakkameskliehpvenassivfnit apsnirmeevheaamiirqnssedadvkfglifddevpddeirvifiatrfpdedkilfpegdipaiyr yglegll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.2340
    Matthews' coefficent Rfactor 0.2032
    Waters 366 Solvent Content 49

    Ligand Information
    Ligands G2P (PHOSPHOMETHYLPHOSPHONIC) x 2
    Metals MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch