.
The Open Protein Structure Annotation Network
PDB Keyword
.

1woo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of T-protein of the Glycine Cleavage System: Cofactor binding, insights into H-protein recognition, and molecular basis for understanding nonketotic hyperglycinemia. J.Biol.Chem. 279 50514-50523 2004
    Site OTHER
    PDB Id 1woo Target Id PDB1WOO
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18702, TM0211 Molecular Weight 40330.42 Da.
    Residues 364 Isoelectric Point 5.45
    Sequence mkrtplfekhvelgakmvdfagwemplyytsifeevmavrksvgmfdvshmgeflvkgpeavsfidflit ndfsslpdgkaiysvmcnenggiiddlvvykvspdealmvvnaaniekdfnwikshsknfdvevsnisd ttaliafqgpkaqetlqelvedgleeiayysfrksivagvetlvsrtgytgedgfelmleaknapkvwd almnllrkidgrpaglgardvcrleatyllygqdmdentnpfevglswvvklnkdfvgkeallkakekv erklvalelsgkriarkgyevlkngervgeitsgnfsptlgksialalvsksvkigdqlgvvfpggklv ealvvkkpfyrgsvrrev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.275
    Matthews' coefficent 2.61 Rfactor 0.218
    Waters 124 Solvent Content 52.82

    Pathway

    Reactions found in Metabolic Reconstruction for TM0211

    Name: "glycine cleavage system, cytosol"
    Metabolic Subsystem: Folate Metabolism
    Reaction: : co2 + mlthf + nadh + nh4 --> gly + nad + thf
    Classification: EC:2.1.2.10
     

    Ligand Information
    Ligands THL (N-[4-({[(6S)-2-AMINO-4-OXO-1,4,5,6,7,8-) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch