.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xje

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural mechanism of allosteric substrate specificity regulation in a ribonucleotide reductase. Nat.Struct.Mol.Biol. 11 1142-1149 2004
    Site OTHER
    PDB Id 1xje Target Id PDB1XJE
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18704, TM0118 Molecular Weight 73272.47 Da.
    Residues 644 Isoelectric Point 6.48
    Sequence mklsdlisrwidvepsknaqiilrdryfmkdldgnyletkwedvarrvarvvataellnpsykknekldr ikewediffrvlkarlfipnsptlfnaglgvkhdllwkpidqmtledyeeiyrsrnhlhmlsacfvvpv gdsieeifeavkeyalitkvgggvgsnfselrpkgsfvagthgkasgpvsfmhvfnsaisvvkqgsrrr galmgilninhpdieefidakkentgeavlnffnlsvgfpmdkkeilklyeedgelelshprstirkkv kirelfrkiatnawksgdpglaflgemnkyyplyphrkinstnpcgeiglsdyeacnlgsidvakfynn gfvdlealqelvqiavrfldnvidvnvfpidkitkavkesrrlglgimgfadllykleipynsqeardf aanlmafialhahrtsyelgkekgnfplleisryrtednfvpfamgmsnyddeirevmkmtkefrrnva lltiaptgsisniadtssglepnfllaytrfvtkedgtkepllyvnqvlreklnpeilkriekeliekg slkdipdvpekikkvfvvaldidpmdhllmqdafqryvdnnisktinmpqsatvddvlnvylealrtnv rgitvyrdgslqtqvltkalkt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.22268
    Matthews' coefficent 2.63 Rfactor 0.18241
    Waters 791 Solvent Content 53.32

    Pathway

    Reactions found in Metabolic Reconstruction for TM0118

    Name: ribonucleoside-diphosphate reductase (UDP)
    Metabolic Subsystem: Purine Metabolism
    Reaction: : trdrd + udp --> dudp + h2o + trdox
    Classification: EC:1.17.4.1
     
    Name: ribonucleoside-diphosphate reductase (ADP)
    Metabolic Subsystem: Purine Metabolism
    Reaction: : adp + trdrd --> dadp + h2o + trdox
    Classification: EC:1.17.4.1
     
    Name: ribonucleoside-diphosphate reductase (GDP)
    Metabolic Subsystem: Purine Metabolism
    Reaction: : gdp + trdrd --> dgdp + h2o + trdox
    Classification: EC:1.17.4.1
     
    Name: ribonucleoside-diphosphate reductase (CDP)
    Metabolic Subsystem: Purine Metabolism
    Reaction: : cdp + trdrd --> dcdp + h2o + trdox
    Classification: EC:1.17.4.1
     

    Ligand Information
    Ligands GDP (GUANOSINE-5'-DIPHOSPHATE) x 2;TTP (THYMIDINE-5'-TRIPHOSPHATE) x 2;GOL (GLYCEROL) x 1
    Metals MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch