.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xzp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of the TrmE GTP-binding protein and its implications for tRNA modification. Embo J. 24 23-33 2005
    Site OTHER
    PDB Id 1xzp Target Id PDB1XZP
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS20030, TM0267 Molecular Weight 16463.21 Da.
    Residues 150 Isoelectric Point 9.59
    Sequence mgsshhhhhhssglvprgshwgspnsssvdklmdtivavatppgkgaiailrlsgpdswkivqkhlrtrs kivprkaihgwihengedvdevvvvfykspksytgedmvevmchggplvvkklldlflksgarmaepge ftkraflngkm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.252
    Matthews' coefficent 4.01 Rfactor 0.226
    Waters 137 Solvent Content 69.10

    Ligand Information
    Ligands SO4 (SULFATE) x 5
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch