.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zav

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Basis for the Function of the Ribosomal L7/12 Stalk in Factor Binding and GTPase Activation. Cell(Cambridge,Mass.) 121 991-1004 2005
    Site OTHER
    PDB Id 1zav Target Id PDB1ZAV
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19972, TM0456 Molecular Weight 20405.83 Da.
    Residues 180 Isoelectric Point 9.20
    Sequence vmltrqqkelivkemseifkktslilfadflgftvadltelrsrlrekygdgarfrvvkntllnlalkna eyegyeeflkgptavlyvtegdpveavkiiynfykdkkadlsrlkggflegkkftaeeveniaklpske elyamlvgrvkapitglvfalsgilrnlvyvlnaikekkse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.274
    Matthews' coefficent 2.70 Rfactor 0.226
    Waters 413 Solvent Content 53.70

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch