.
The Open Protein Structure Annotation Network
PDB Keyword
.

2bty

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Bases of Feed-Back Control of Arginine Biosynthesis, Revealed by the Structure of Two Hexameric N-Acetylglutamate Kinases, from Thermotoga Maritima and Pseudomonas Aeruginosa. J.Mol.Biol. 356 695 2006
    Site OTHER
    PDB Id 2bty Target Id PDB2BTY
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18732, TM1784 Molecular Weight 30343.00 Da.
    Residues 282 Isoelectric Point 6.09
    Sequence mridtvnvllealpyikefygktfvikfggsamkqenakkafiqdiillkytgikpiivhgggpaisqmm kdlgiepvfknghrvtdektmeivemvlvgkinkeivmnlnlhggravgicgkdsklivaeketkhgdi gyvgkvkkvnpeilhaliendyipviapvgigedghsyninadtaaaeiakslmaeklilltdvdgvlk dgklistltpdeaeelirdgtvtggmipkvecavsavrggvgavhiingglehailleifsrkgigtmi keleg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.75 Rfree 0.273
    Matthews' coefficent 3.2 Rfactor 0.242
    Waters 46 Solvent Content 61.2

    Pathway

    Reactions found in Metabolic Reconstruction for TM1784

    Name: acetylglutamate kinase
    Metabolic Subsystem: Arginine Biosynthesis
    Reaction: : acglu + atp --> acg5p + adp
    Classification: EC:2.7.2.8
     

    Ligand Information
    Ligands ARG (N-ACETYL-L-GLUTAMATE) x 3;NLG x 3
    Metals K (POTASSIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch