.
The Open Protein Structure Annotation Network
PDB Keyword
.

2c2a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the Entire Cytoplasmic Portion of a Sensor Histidine-Kinase Protein. Embo J. 24 4247 2005
    Site OTHER
    PDB Id 2c2a Target Id PDB2C2A
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19970, TM0853 Molecular Weight 29370.79 Da.
    Residues 258 Isoelectric Point 5.02
    Sequence menvteskelerlkridrmktefianishelrtpltaikayaetiynslgeldlstlkefleviidqsnh lenllnelldfsrlerkslqinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpveayidptri rqvllnllnngvkyskkdapdkyvkvildekdggvliivedngigipdhakdrifeqfyrvdssltyev pgtglglaitkeivelhggriwvesevgkgsrffvwipkdragednrqdn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.9 Rfree 0.2752
    Matthews' coefficent 2.3 Rfactor 0.2465
    Waters 179 Solvent Content 46.5

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 1;SO4 (SULFATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch