The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Reconstruction of the Chemotaxis Receptor-Kinase Assembly. Nat.Struct.Mol.Biol. 13 400 2006
    Site OTHER
    PDB Id 2ch7 Target Id PDB2CH7
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26109, TM1143 Molecular Weight 33364.06 Da.
    Residues 309 Isoelectric Point 4.52
    Sequence gshmkdvqtetfsvaesieeiskaneeitnqllgiskemdnistriesisasvqettagseeissatkni adsaqqaasfadqstqlakeagdalkkvievtrmisnsakdvervvesfqkgaeeitsfvetinaiaeq tnllalnaaieaarageagrgfavvadeirklaeesqqasenvrrvvneirsiaedagkvsseitarve egtkladeadeklnsivgaverinemlqniaaaieeqtaavdeittamtenaknaeeitnsvkevnarl qeisasteevtsrvqtirenvqmlkeivaryk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.5 Rfree 0.2971
    Matthews' coefficent 2.14 Rfactor 0.2587
    Waters 584 Solvent Content 42

    Ligand Information
    Metals PB (LEAD) x 2



    Protein Summary


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch