.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f9z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A receptor-modifying deamidase in complex with a signaling phosphatase reveals reciprocal regulation. Cell(Cambridge,Mass.) 124 561-571 2006
    Site OTHER
    PDB Id 2f9z Target Id PDB2F9Z
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS20016, TM0903 Molecular Weight 22548.16 Da.
    Residues 205 Isoelectric Point 4.45
    Sequence mkiserqkdllkeignigagnaataisyminkkveisvpnveivpiskvifiakdpeeivvgvkmpvtgd iegsvllimgttvvkkileiltgrapdnllnldefsasalreignimcgtyvsaladflgfkidtlppq lvidmisaifaeasieelednsedqivfvetllkveeeeepltsymmmipkpgylvkifermgiqe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.275
    Matthews' coefficent 2.58 Rfactor 0.211
    Waters 392 Solvent Content 52.37

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch