.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fnc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of redundant maltotriose binding proteins from the thermophile Thermotoga maritima. To be Published
    Site OTHER
    PDB Id 2fnc Target Id PDB2FNC
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26075, TM1839 Molecular Weight 41787.93 Da.
    Residues 381 Isoelectric Point 5.16
    Sequence mkltiwcsekqvdilqklgeefkakygipvevqyvdfgsikskfltaapqgqgadiivgahdwvgelavn gliepipnfsdlknfydtalkafsyggklygvpyameavaliynkdyvdsvpktmdeliekakqideey ggevrgfiydvanfyfsapfilgyggyvfketpqgldvtdiglanegavkgaklikrmidegvltpgdn ygtmdsmfkeglaamiinglwaiksykdaginygvapipelepgvpakpfvgvqgfminakspnkviam efltnfiarketmykiyladprlparkdvlelvkdnpdvvaftqsasmgtpmpnvpemapvwsamgdal siiingqasvedalkeavekikaqiekgshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.23
    Matthews' coefficent 2.13 Rfactor 0.194
    Waters 330 Solvent Content 42.21

    Pathway

    Reactions found in Metabolic Reconstruction for TM1839

    Name: trehalose transport via ABC system
    Other genes that carryout this rxn:TM1837 TM1836
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + tre[e] --> adp[c] + h[c] + pi[c] + tre[c]

     
    Name: Maltotriose transport via ABC system
    Other genes that carryout this rxn:TM1204 TM1202 TM1203 TM1837 TM1836
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + malttr[e] --> adp[c] + h[c] + malttr[c] + pi[c]

     
    Name: maltose transport via ABC system
    Other genes that carryout this rxn:TM1837 TM1836 TM1204 TM1202 TM1203
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + malt[e] --> adp[c] + h[c] + malt[c] + pi[c]

     

    Ligand Information
    Ligands MLR (MALTOTRIOSE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch