.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gai

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Full Length Topoisomerase I from Thermotoga maritima. J.Mol.Biol. 358 1328-1340 2006
    Site OTHER
    PDB Id 2gai Target Id PDB2GAI
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19990, TM0258 Molecular Weight 72675.07 Da.
    Residues 633 Isoelectric Point 9.41
    Sequence makkvkkyivvespakaktiksilgneyevfasmghiidlpkskfgvdlekdfepefavikgkekvvekl kdlakkgelliasdmdregeaiawhiarvtntlgrknrivfseitprvireavknpreidmkkvraqla rrildrivgyslspvlwrnfksnlsagrvqsatlklvcdrereilrfvpkkyhritvnfdgltaeidvk ekkffdaetlkeiqsidelvveekkvsvkkfappepfktstlqqeaysklgfsvsktmmiaqqlyegve tkdghiafitymrtdstrvsdyakeearnlitevfgeeyvgskrerrksnakiqdaheairptnvfmtp eeagkylnsdqkklyeliwkrflasqmkpsqyeetrfvlrtkdgkyrfkgtvlkkifdgyekvwktern tgefpfeegesvkpvvvkieeqetkpkprytegslvkemerlgigrpstyastiklllnrgyikkirgy lyptivgsvvmdylekkysdvvsvsftaemekdldeveqgkktdkivlrefyesfssvfdrndrivvdf ptnqkcscgkemrlsfgkygfylkcecgktrsvkndeiaviddgkiflgrkdsesgspdgrsvegkgnl sekrrkgkkgs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.232
    Matthews' coefficent 2.82 Rfactor 0.197
    Waters 1054 Solvent Content 56.34

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch