.
The Open Protein Structure Annotation Network
PDB Keyword
.

2h3h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure-based design of robust glucose biosensors using a Thermotoga maritima periplasmic glucose-binding protein. Protein Sci. 16 2240-2250 2007
    Site OTHER
    PDB Id 2h3h Target Id PDB2H3H
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26063, TM0114 Molecular Weight 33865.38 Da.
    Residues 313 Isoelectric Point 5.38
    Sequence mltigvigksvhpywsqveqgvkaagkalgvdtkffvpqkedinaqlqmlesfiaegvngiaiapsdpta viptikkalemgipvvtldtdspdsgryvyigtdnyqagytaglimkellggkgkvvigtgsltamnsl qriqgfkdaikdseieivdilndeedgaravslaeaalnahpdldaffgvyayngpaqalvvknagkvg kvkivcfdttpdilqyvkegviqatmgqrpymmgylsvtvlylmnkigvqntlmmlpkvkvdgkvdyvi dtgvdvvtpenldeylkkmeelgipikfgshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.24108
    Matthews' coefficent 2.83 Rfactor 0.20306
    Waters 668 Solvent Content 56.53

    Pathway

    Reactions found in Metabolic Reconstruction for TM0114

    Name: D-xylose transport via ABC system
    Other genes that carryout this rxn: TM0112 TM0115 TM0060 TM0058 TM0056 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + xyl-D[e] --> adp[c] + h[c] + pi[c] + xyl-D[c]

     

    Ligand Information
    Ligands BGC (BETA-D-GLUCOSE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch