.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hpg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of a periplasmic binding protein in the tripartite ATP-independent transporter family reveals a tetrameric assembly that may have a role in ligand transport. J.Biol.Chem. 283 32812-32820 2008
    Site OTHER
    PDB Id 2hpg Target Id PDB2HPG
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26093, TM0322 Molecular Weight 37270.08 Da.
    Residues 327 Isoelectric Point 6.11
    Sequence msavfgakytlrfghvlapgepyhqaflkwakaveektngdvrievfpssqlgveediieqirmgapvgw ntdsarlgmyvkdigvmnlayfidfmgaktpeeaievlkkikqsptmqkwlkeleqrfgikvlsfywvq gyrhfvtnkpirkpedlnglrirtpgapawqesirslgaipvavnfgeiytavqtravdgaeltyanvy ngglyevlkymsetghfllinfeivsadwfnslpkeyqkiieeemdkagievslkimkeleeeykqkci ekgmavipaseidkeafmekakqayknlglenalnqlikevkgehhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.239
    Matthews' coefficent 2.91 Rfactor 0.213
    Waters 529 Solvent Content 57.72

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch