The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Acetate kinase from a hypothermophile Thermotoga maritima. To be Published
    Site OTHER
    PDB Id 2iir Target Id PDB2IIR
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26071, TM0274 Molecular Weight 44801.47 Da.
    Residues 403 Isoelectric Point 5.91
    Sequence mrvlvinsgsssikyqliemegekvlckgiaerigiegsrlvhrvgdekhvierelpdheealklilntl vdeklgvikdlkeidavghrvvhggerfkesvlvdeevlkaieevsplaplhnpanlmgikaamkllpg vpnvavfdtafhqtipqkaylyaipyeyyekykirrygfhgtshryvskraaeilgkkleelkiitchi gngasvaavkygkcvdtsmgftpleglvmgtrsgdldpaipffimekegispqemydilnkksgvygls kgfssdmrdieeaalkgdewcklvleiydyriakyigayaaamngvdaivftagvgenspitredvcsy leflgvkldkqkneetirgkegiistpdsrvkvlvvptneelmiardtkeivekigr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 3.30 Rfree 0.253
    Matthews' coefficent 2.95 Rfactor 0.229
    Waters 50 Solvent Content 58.35


    Reactions found in Metabolic Reconstruction for TM0274

    Name: acetate kinase
    Metabolic Subsystem: Pyruvate Met
    Reaction: : ac + atp <==> actp + adp
    Classification: EC:

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch