.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zsg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of X-Pro aminopeptidase from Thermotoga maritima MSB8. To be Published
    Site OTHER
    PDB Id 2zsg Target Id PDB2ZSG
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26087, TM0042 Molecular Weight 39937.39 Da.
    Residues 359 Isoelectric Point 4.95
    Sequence mdrserliqliseegidaflimniensarassvyfsgftgsfsiilisentrllitdsrytvqakqetdf evrevkggdfidvlkktvndlkiktialeeervslslfrrissafgdrkfigiddevkqmrmvkdegei ekikqaieiserafletvqqiragmtekeiaalleytmrkegaegvafdtivasgcrsalphgkasdkv vergdvividfgatyenycaditrvvsigepsdevkevhsivleaqeralkiakagvtgklldsvaref irekgygeffghslghgiglevhegpaisfrndsplpenvvftvepgiylegkfgirieedvvlkeqgc eilttlprsifvv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.215
    Matthews' coefficent 2.21 Rfactor 0.191
    Waters 780 Solvent Content 44.28

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals NA (SODIUM) x 3;ZN (ZINC) x 1;CL (CHLORIDE) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch