The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a complex of the ATPase SecA and the protein-translocation channel. Nature 455 936-943 2008
    Site OTHER
    PDB Id 3din Target Id PDB3DIN
    Molecular Characteristics
    Source Thermotoga sp. rq2
    Alias Ids TPS26085, TM1480 Molecular Weight 100480.62 Da.
    Residues 871 Isoelectric Point 6.86
    Sequence milfdknkrilkkyakmvskinqiesdlrskknselirlsmvlkekvnsfedadehlfeafalvreaarr tlgmrpfdvqvmggialhegkvaemktgegktlaatmpiylnaligkgvhlvtvndylarrdalwmgpv ylflglrvgvinslgksyevvwknpdlarkaieenwsvwpdgfngevlkeesmnkeaveafqvelkeit rkeaylcdvtygtnnefgfdylrdnlvldyndkvqrghfyaivdeadsvlideartpliisgpskesps vyrrfaqiakkfvkdkdftvdekartiilteegvakaekiigvenlydpgnvsllyhlinalkalhlfk kdvdyvvmngeviivdeftgrllpgrrysgglhqaieakegvpikeesityatitfqnyfrmyeklagm tgtakteesefvqvygmevvvipthkpmirkdhddlvfrtqkekyekiveeiekrykkgqpvlvgttsi eksellssmlkkkgiphqvlnakyhekeaeivakagqkgmvtiatnmagrgtdiklgpgvaelgglcii gterhesrridnqlrgragrqgdpgesifflsleddllrifgseqigkvmnilkieegqpiqhpmlskl ieniqkkveginfsirktlmemddvldkqrravyslrdqillekdydeylkdifedvvstrveefcsgk nwdieslknslsffpaglfdldekqfssseelhdylfnrlweeyqrkkqeigedyrkvirflmlriidd hwrryleevehvkeavqlrsygqkdpivefkketyymfdemmrrindtianyvlrvvkvsekdekeake elgkirlvheefnlvnramrratekkkkkdglhsfgrirvkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 4.50 Rfree 0.303
    Matthews' coefficent 4.32 Rfactor 0.279
    Waters Solvent Content 71.50

    Ligand Information
    Metals MG (MAGNESIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch