The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of enzyme encapsulation into a bacterial nanocompartment. Nat.Struct.Mol.Biol. 15 939-947 2008
    Site OTHER
    PDB Id 3dkt Target Id PDB3DKT
    Molecular Characteristics
    Source Thermotoga sp.
    Alias Ids TPS26103, TM0785 Molecular Weight 30476.22 Da.
    Residues 265 Isoelectric Point 4.90
    Sequence meflkrsfapltekqwqeidnrareifktqlygrkfvdvegpygweyaahplgevevlsdenevvkwglr kslplielratftldlweldnlergkpnvdlssleetvrkvaefedevifrgceksgvkgllsfeerki ecgstpkdlleaivralsifskdgiegpytlvintdrwinflkeeaghyplekrveeclrggkiittpr iedalvvserggdfklilgqdlsigyedrekdavrlfitetftfqvvnpealillkf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 3.10 Rfree 0.239
    Matthews' coefficent 9.89 Rfactor 0.219
    Waters 100 Solvent Content 87.57

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch