.
The Open Protein Structure Annotation Network
PDB Keyword
.

1a8h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 2.0 A crystal structure of Thermus thermophilus methionyl-tRNA synthetase reveals two RNA-binding modules. Structure 8 197-208 2000
    Site RSGI
    PDB Id 1a8h Target Id ttk003000875.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14466, Molecular Weight 70689.73 Da.
    Residues 618 Isoelectric Point 6.04
    Sequence mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraaqaagedpka fvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyygeyeglycvscerfyteke lveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdlirpegyrnevlamlaepigdlsisrpk srvpwgiplpwdenhvtyvwfdallnyvsaldypegeayrtfwphawhligkdilkphavfwptmlkaa gipmyrhlnvggfllgpdgrkmsktlgnvvdpfallekygrdalryyllreipygqdtpvseealrtry eadladdlgnlvqrtramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeamayvkal nryinekkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralglkeevrleeaerwgl aeprpipeeapvlfpkkeakveakpkeeawigiedfakvelrvaevlaaekhpnadrllvlrlslgnee rtvvsgiakwyrpeelvgkkvvlvanlkpaklrgiesqgmilaaqegealalvtvegevppgavvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2830000
    Matthews' coefficent 2.37 Rfactor 0.2050000
    Waters 135 Solvent Content 48.10

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch