.
The Open Protein Structure Annotation Network
PDB Keyword
.

1aa3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title An interaction between a specified surface of the C-terminal domain of RecA protein and double-stranded DNA for homologous pairing. J.Mol.Biol. 274 213-221 1997
    Site RSGI
    PDB Id 1aa3 Target Id my_001000015.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS13678, Molecular Weight 7096.78 Da.
    Residues 63 Isoelectric Point 8.15
    Sequence infygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrelllsn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch