.
The Open Protein Structure Annotation Network
PDB Keyword
.

1aa9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Regional polysterism in the GTP-bound form of the human c-Ha-Ras protein. Biochemistry 36 9109-9119 1997
    Site RSGI
    PDB Id 1aa9 Target Id trt001000212.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14104, Molecular Weight 19491.07 Da.
    Residues 171 Isoelectric Point 5.27
    Sequence mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtagqeeysamrd qymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesrqaqdlarsyg ipyietsaktrqgvedafytlvreirqhklrkl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands GDP (GUANOSINE-5'-DIPHOSPHATE) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch