The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The N-terminal domain of the human Rad51 protein binds DNA: structure and a DNA binding surface as revealed by NMR. J.Mol.Biol. 290 495-504 1999
    Site RSGI
    PDB Id 1b22 Target Id trt001000204.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14098, Molecular Weight 12531.64 Da.
    Residues 114 Isoelectric Point 5.05
    Sequence mamqmqleanadtsveeesfgpqpisrleqcginandvkkleeagfhtveavayapkkelinikgisea kadkilaeaaklvpmgfttatefhqrrseiiqittgskeldkllq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch