.
The Open Protein Structure Annotation Network
PDB Keyword
.

1b7f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for recognition of the tra mRNA precursor by the Sex-lethal protein. Nature 398 579-585 1999
    Site RSGI
    PDB Id 1b7f Target Id trt001000189.1
    Molecular Characteristics
    Source Drosophila melanogaster
    Alias Ids TPS14094, Molecular Weight 18946.57 Da.
    Residues 168 Isoelectric Point 9.57
    Sequence asntnlivnylpqdmtdrelyalfraigpintcrimrdyktgysygyafvdftsemdsqraikvlngit vrnkrlkvsyarpggesikdtnlyvtnlprtitddqldtifgkygsivqknilrdkltgrprgvafvry nkreeaqeaisalnnvipeggsqplsvrla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.2940000
    Matthews' coefficent 2.80 Rfactor 0.2010000
    Waters 84 Solvent Content 59.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch