The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the central core domain of TFIIEbeta with a novel double-stranded DNA-binding surface. EMBO J. 19 1346-1356 2000
    Site RSGI
    PDB Id 1d8j Target Id trt001000205.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14099, Molecular Weight 9272.25 Da.
    Residues 81 Isoelectric Point 9.26
    Sequence alsgssgykfgvlakivnymktrhqrgdthpltldeildetqhldiglkqkqwlmtealvnnpkievid gkyafkpkynvr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch