.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ee8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a repair enzyme of oxidatively damaged DNA, MutM (Fpg), from an extreme thermophile, Thermus thermophilus HB8. EMBO J. 19 3857-3869 2000
    Site RSGI
    PDB Id 1ee8 Target Id ttk003000730.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14422, Molecular Weight 29913.78 Da.
    Residues 267 Isoelectric Point 10.27
    Sequence mpelpevettrrrlrplvlgqtlrqvvhrdparyrntalaegrrilevdrrgkfllfaleggvelvahl gmtggfrleptphtraalvlegrtlyfhdprrfgrlfgvrrgdyreiplllrlgpeplseafafpgffr glkesarplkallldqrlaagvgniyadealfrarlspfrparslteeearrlyralrevlaeavelgg stlsdqsyrqpdglpggfqtrhavygreglpcpacgrpverrvvagrgthfcptcqgegp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.2580000
    Matthews' coefficent 2.24 Rfactor 0.2140000
    Waters 292 Solvent Content 45.11

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch