.
The Open Protein Structure Annotation Network
PDB Keyword
.

1fjd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the human parvulin-like peptidyl prolyl cis/trans isomerase, hPar14. J.Mol.Biol. 305 917-926 2001
    Site RSGI
    PDB Id 1fjd Target Id nhs001015441.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13755, Molecular Weight 11166.49 Da.
    Residues 102 Isoelectric Point 9.52
    Sequence gpkgggnavkvrhilcekhgkimeameklksgmrfnevaaqysedkarqggdlgwmtrgsmvgpfqeaa falpvsgmdkpvftdppvktkfgyhiimvegrk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch