The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for anticodon recognition by discriminating glutamyl-tRNA synthetase. Nat.Struct.Biol. 8 203-206 2001
    Site RSGI
    PDB Id 1g59 Target Id trt001000193.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14096, Molecular Weight 47244.69 Da.
    Residues 408 Isoelectric Point 6.07
    Sequence kwlglsydegpdvaaptgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekggydgrarni ppeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllksdgyptyhlanvvddhlm gvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpdktkiskrkshtsldwykaegflpealr nylclmgfsmpdgreiftleefiqaftwervslggpvfdleklrwmngkyirevlsleevaervkpflr eaglsweseaylrravelmrprfdtlkefpekarylftedypvsekaqrkleeglpllkelyprlraqe ewteaaleallrgfaaekgvklgqvaqplraaltgsletpglfeilallgkeralrrlerala
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.2980000
    Matthews' coefficent 2.53 Rfactor 0.2180000
    Waters 272 Solvent Content 51.30

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch