The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for double-sieve discrimination of L-valine from L-isoleucine and L-threonine by the complex of tRNA(Val) and valyl-tRNA synthetase. Cell(Cambridge,Mass.) 103 793-803 2000
    Site RSGI
    PDB Id 1gax Target Id trt001000217.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14110, Molecular Weight 98770.03 Da.
    Residues 862 Isoelectric Point 5.84
    Sequence mdlpkaydpksvepkwaekwaknpfvanpksgkppfvifmpppnvtgslhmghaldnslqdalirykrm rgfeavwlpgtdhagiatqvvverlllkegktrhdlgrekflervwqwkeesggtilkqlkrlgasadw sreaftmdekrsravryafsryyheglayraprlvnwcprcettlsdleveteptpgklytlryevegg gfieiatvrpetvfadqaiavhpederyrhllgkraripltevwipiladpavekdfgtgalkvtpahd pldyeigerhglkpvsvinlegrmegervpealrgldrfearrkavelfreaghlvkeedytialatcs rcgtpieyaifpqwwlrmrplaeevlkglrrgdiafvperwkkvnmdwlenvkdwnisrqlwwghqipa wycedcqavnvprperyledptsceacgsprlkrdedvfdtwfssalwplstlgwpeetedlkafypgd vlvtgydilflwvsrmevsgyhfmgerpfktvllhglvldekgqkmskskgnvidplemverygadalr faliylatggqdirldlrwlemarnfanklynaarfvllsregfqakedtptladrfmrsrlsrgveei talyealdlaqaarevyelvwsefcdwyleaakpalkagnahtlrtleevlavllkllhpmmpfltsel yqaltgkeelaleawpepggrdeeaerafealkqavtavralkaeaglppaqevrvylegetapveenl evfrflsradllperpakalvkamprvtarmpleglldveewrrrqekrlkellalaersqrklaspgf rekapkevveaeearlkenleqaerirealsqig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.90 Rfree 0.2715
    Matthews' coefficent Rfactor 0.2447
    Waters 158 Solvent Content

    Ligand Information
    Metals ZN (ZINC) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch