The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a T7 RNA Polymerase Elongation Complex at 2.9 A Resolution. Nature 420 43 2002
    Site RSGI
    PDB Id 1h38 Target Id trt001000257.1
    Molecular Characteristics
    Source Bacteriophage t7
    Alias Ids TPS14116, Molecular Weight 98850.09 Da.
    Residues 883 Isoelectric Point 6.77
    Sequence mntiniakndfsdielaaipfntladhygerlareqlalehesyemgearfrkmferqlkagevadnaa akplittllpkmiarindwfeevkakrgkrptafqflqeikpeavayitikttlacltsadnttvqava saigraiedearfgrirdleakhfkknveeqlnkrvghvykkafmqvveadmlskgllggeawsswhke dsihvgvrciemliestgmvslhrqnagvvgqdsetielapeyaeaiatragalagispmfqpcvvppk pwtgitgggywangrrplalvrthskkalmryedvympevykainiaqntawkinkkvlavanvitkwk hcpvedipaiereelpmkpedidmnpealtawkraaaavyrkdkarksrrislefmleqankfanhkai wfpynmdwrgrvyavsmfnpqgndmtkglltlakgkpigkegyywlkihgancagvdkvpfperikfie enhenimacaksplentwwaeqdspfcflafcfeyagvqhhglsyncslplafdgscsgiqhfsamlrd evggravnllpsetvqdiygivakkvneilqadaingtdnevvtvtdentgeisekvklgtkalagqwl aygvtrsvtkrsvmtlaygskefgfrqqvledtiqpaidsgkglmftqpnqaagymakliwesvsvtvv aaveamnwlksaakllaaevkdkktgeilrkrcavhwvtpdgfpvwqeykkpiqtrlnlmflgqfrlqp tintnkdseidahkqesgiapnfvhsqdgshlrktvvwahekygiesfalihdsfgtipadaanlfkav retmvdtyescdvladfydqfadqlhesqldkmpalpakgnlnlrdilesdfafa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.90 Rfree 0.284
    Matthews' coefficent Rfactor 0.236
    Waters 1162 Solvent Content

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch