.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ile

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Enzyme structure with two catalytic sites for double-sieve selection of substrate. Science 280 578-582 1998
    Site RSGI
    PDB Id 1ile Target Id ttk003000883.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14472, Molecular Weight 119351.62 Da.
    Residues 1043 Isoelectric Point 5.96
    Sequence mfkevgepnfpkleeevlafwkrekifqksvenrkggprytvyegpptanglphvghaqarsykdlfpr yktmrgyyaprragwdthglpvelevekklglkskreieaygierfnqacresvftyekeweafteria ywvdlenayatleptyiesiwwslknlfdrgllyrdhkvvpycprcgtplsshevalgykeiqdpsvyv rfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealileeglgrkllgegtpvl ktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhqapafgaedletarvyglpllktvde egkllvepfkglyfreanrailrdlrgrgllfkeesylhsyphcwrcstplmyyateswfikntlfkde lirknqeihwvpphikegrygewlknlvdwalsrnrywgtplpiwvcqacgkeeaigsfqelkaratkp lpepfdphrpyvdqvelacacggtmrrvpyvidvwydsgampfaslhypfeheevfresfpadfiaegi dqtrgwfnflhqlgvmlfgsiafknvichglilyemgqkmskskgnvvdpwdiirefgadalrwyiyvs appeadrrfgpnlvretvrdyfltlwnvysffvtyanldrpdlknppppekrpemdrwllarmqdliqr vtealeaydpttsaralrdfvvedlsqwyvrrnrrrfwknedaldreaayatlyealvlvatlaapftp flaevlwqnlvrsvrpeakesvhladwpeadpaladealvaqmravlkvvdlaraaraksgvktrtplp lllvtaptalereglkrfaheiaeelnvkevrvlepgeeilsyrvlpnlkllgrkygklvpkirealqr ereraaalalkgeaiplevegealtllpeevlleaeapkgyqalekdgyvaalkvevtealrmeglard lirllqqarkdmglkvsdrirvgyeaegpylealkrhgpwiaeevlatafgeglfggfearvedeegkavfhlarae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.298
    Matthews' coefficent 4.11 Rfactor 0.222
    Waters 322 Solvent Content 63.00

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch